PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0049s0080.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 497aa    MW: 54381.3 Da    PI: 5.5695
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0049s0080.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1085.2e-34266320155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+r+rWtpeLHe+F+eav+qLGGse+AtPk +l+lmkv+gLt++hvkSHLQkYR+
  Kalax.0049s0080.3.p 266 KQRMRWTPELHEAFIEAVNQLGGSERATPKGVLKLMKVEGLTIYHVKSHLQKYRT 320
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.597263323IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-31264322IPR009057Homeodomain-like
SuperFamilySSF466891.15E-17265320IPR009057Homeodomain-like
TIGRFAMsTIGR015575.1E-25266320IPR006447Myb domain, plants
PfamPF002493.6E-10268319IPR001005SANT/Myb domain
PfamPF143798.6E-26351398IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MDAPHMSIYG SGAKQHVGVS AACSSSLPVI PTHLQETFPK HSDPQQIYMG REVMTGSMAR  60
HNNSLPSHSG AAGHIISFPS GYSTSLRFSS VSVHEKQPSN SVFISQSSCD RKAMLSANSN  120
GSGKLQSDTL MQYPRESENS SWCADSLQGF LDFRTPLDEN HLESTISGTA SVELAKQNDW  180
QEWADHFITD DDALNTNWSD LLVDATVESL EPEVPKPPSD AAIQQPQPQP QPQVQPQAQL  240
LLHPASSCET VVLPVPASSS SNSAAKQRMR WTPELHEAFI EAVNQLGGSE RATPKGVLKL  300
MKVEGLTIYH VKSHLQKYRT ARYRPDPSEA TSLRNVTPIE EFSSLDLKTG IEITEALRLQ  360
MEVQKRLHEQ LEIQRNLQLR IEEQGRYLQM MFEKQCKSVP DSNKLKTSSS TIENLSALSA  420
PVSSGNGKTE ETSELDASKA VNVLVQSVAP ESEASGNKVG AKRRSPDTEE GSDNTEHDDA  480
SHSQQKRAKN NDEGSV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002270511.11e-161PREDICTED: protein PHR1-LIKE 1
TrEMBLF6HZP91e-160F6HZP9_VITVI; Putative uncharacterized protein
STRINGVIT_07s0005g04120.t011e-160(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.12e-96phosphate starvation response 1